PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_16018_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 175aa    MW: 19342.1 Da    PI: 10.7185
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_16018_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA84.61.6e-2659115158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 d p+YVNa+Qy++I++RR  Rak++ e+k+ +k+rkpylh SRh hA+r pRg+gG F
  Cotton_A_16018_BGI-A2_v1.0  59 DGPIYVNARQYNGIIRRRRYRAKAALETKV-TKARKPYLHYSRHLHAVRHPRGNGGLF 115
                                 57****************************.*************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-2857118IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115230.50858118IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-186183IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-2261115IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-1892115IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MLKAIISRQQ SLQSEHGLGQ PMVCAKYPYL MDQGYGVLPT FGPQISGRVM LPLNLATEDG  60
PIYVNARQYN GIIRRRRYRA KAALETKVTK ARKPYLHYSR HLHAVRHPRG NGGLFLNTKS  120
SNTGKDGMQM MKANEGQLSR LTGSQISQVL QSDSGTINSY KEPNGGGSTF SGSER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-1459123266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028005.16e-83Nuclear transcription factor Y subunit A-10, putative
SwissprotQ8LFU09e-42NFYAA_ARATH; Nuclear transcription factor Y subunit A-10
TrEMBLA0A0D2SFL41e-102A0A0D2SFL4_G
STRINGPOPTR_0016s06860.17e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.31e-37nuclear factor Y, subunit A10